PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1033711g010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family GATA
Protein Properties Length: 241aa    MW: 26069.6 Da    PI: 7.467
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1033711g010genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.95.9e-18169203135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         Cs+C + kTp+WR gp g+ktLCnaCG+++++ +l
  PDK_30s1033711g010 169 CSHCLSHKTPQWRAGPLGPKTLCNACGVRFKSGRL 203
                         *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.4E-16163217IPR000679Zinc finger, GATA-type
PROSITE profilePS5011410.857167199IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.47E-14167227No hitNo description
Gene3DG3DSA:3.30.50.101.8E-13167201IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.84E-14168225No hitNo description
PROSITE patternPS003440169194IPR000679Zinc finger, GATA-type
PfamPF003209.4E-16169203IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MDISADTSVS GGGPAGPLLG EFVPFVPGEP AEGGEDVSLE WLSIYMEDCL SGTTSYTTTS  60
QPLPPPTTSH DTPSPKPPQP QNPTKTSSLD DLAIPAKART KRRRVTTPKA LTSQDPLLFF  120
HQTCWLADSE LILPKKEQED EAPAVESLEG GGGGEAGEKI GKELQIRRCS HCLSHKTPQW  180
RAGPLGPKTL CNACGVRFKS GRLLPEYRPA KSPTFVSYKH SNSHKKVMEM RMMAILSSQS  240
N
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100104KRRRV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008805375.11e-147PREDICTED: GATA transcription factor 2-like
TrEMBLM0SQV24e-67M0SQV2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P21390_0011e-66(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.18e-36GATA transcription factor 2